Recombinant Human BMP2 Protein, GST-tagged
| Cat.No. : | BMP2-261H |
| Product Overview : | Human BMP2 partial ORF (NP_001191, 231 a.a. - 330 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 231-330 a.a. |
| Description : | The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
| Official Symbol | BMP2 |
| Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
| Gene ID | 650 |
| mRNA Refseq | NM_001200 |
| Protein Refseq | NP_001191 |
| MIM | 112261 |
| UniProt ID | P12643 |
| ◆ Recombinant Proteins | ||
| BMP2-5929C | Recombinant Chicken BMP2 | +Inquiry |
| BMP2-6743H | Recombinant Human BMP2 protein, His-tagged | +Inquiry |
| BMP2-558D | Recombinant Dog BMP2 protein, His-tagged | +Inquiry |
| Bmp2-565R | Recombinant Rat Bmp2 protein, His-tagged | +Inquiry |
| BMP2-02H | Recombinant Human/Mouse/Rat/Bovine/Porcine BMP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *
