Recombinant Human BMP2K protein, His&Myc-tagged
| Cat.No. : | BMP2K-1212H |
| Product Overview : | Recombinant Human BMP2K protein(Q9NSY1)(39-344aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 39-344aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTAS |
| Gene Name | BMP2K BMP2 inducible kinase [ Homo sapiens ] |
| Official Symbol | BMP2K |
| Synonyms | BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116; |
| Gene ID | 55589 |
| mRNA Refseq | NM_017593 |
| Protein Refseq | NP_060063 |
| UniProt ID | Q9NSY1 |
| ◆ Recombinant Proteins | ||
| BMP2K-263H | Recombinant Human BMP2K Protein, GST-tagged | +Inquiry |
| BMP2K-1930Z | Recombinant Zebrafish BMP2K | +Inquiry |
| Bmp2k-225M | Recombinant Mouse Bmp2k, GST-tagged | +Inquiry |
| BMP2K-1723HF | Recombinant Full Length Human BMP2K Protein, GST-tagged | +Inquiry |
| Bmp2k-1006M | Recombinant Mouse Bmp2k Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2K Products
Required fields are marked with *
My Review for All BMP2K Products
Required fields are marked with *




