Recombinant Human BMP2K protein, His&Myc-tagged
Cat.No. : | BMP2K-1212H |
Product Overview : | Recombinant Human BMP2K protein(Q9NSY1)(39-344aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 39-344aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTAS |
Gene Name | BMP2K BMP2 inducible kinase [ Homo sapiens ] |
Official Symbol | BMP2K |
Synonyms | BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116; |
Gene ID | 55589 |
mRNA Refseq | NM_017593 |
Protein Refseq | NP_060063 |
UniProt ID | Q9NSY1 |
◆ Recombinant Proteins | ||
BMP2K-1723HF | Recombinant Full Length Human BMP2K Protein, GST-tagged | +Inquiry |
BMP2K-1298HFL | Recombinant Full Length Human BMP2K Protein, C-Flag-tagged | +Inquiry |
BMP2K-1212H | Recombinant Human BMP2K protein, His&Myc-tagged | +Inquiry |
Bmp2k-225M | Recombinant Mouse Bmp2k, GST-tagged | +Inquiry |
BMP2K-1053M | Recombinant Mouse BMP2K Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2K Products
Required fields are marked with *
My Review for All BMP2K Products
Required fields are marked with *