Recombinant Human BMP3 Protein, GST-tagged

Cat.No. : BMP3-265H
Product Overview : Human BMP3 partial ORF ( NP_001192, 373 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP3 bone morphogenetic protein 3 [ Homo sapiens ]
Official Symbol BMP3
Synonyms BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A;
Gene ID 651
mRNA Refseq NM_001201
Protein Refseq NP_001192
MIM 112263
UniProt ID P12645

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP3 Products

Required fields are marked with *

My Review for All BMP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon