Recombinant Human BMP3 Protein, GST-tagged
| Cat.No. : | BMP3-265H |
| Product Overview : | Human BMP3 partial ORF ( NP_001192, 373 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BMP3 bone morphogenetic protein 3 [ Homo sapiens ] |
| Official Symbol | BMP3 |
| Synonyms | BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A; |
| Gene ID | 651 |
| mRNA Refseq | NM_001201 |
| Protein Refseq | NP_001192 |
| MIM | 112263 |
| UniProt ID | P12645 |
| ◆ Recombinant Proteins | ||
| BMP3-2545H | Recombinant Human BMP3 Protein (363-472 aa), His-Myc-tagged | +Inquiry |
| BMP3-2438H | Recombinant Human BMP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BMP3-10251H | Recombinant Human BMP3, His-tagged | +Inquiry |
| BMP3-2588M | Recombinant Mouse BMP3 Protein (359-468 aa), His-tagged | +Inquiry |
| BMP3-265H | Recombinant Human BMP3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *
