Recombinant Human BMP3 Protein, GST-tagged
Cat.No. : | BMP3-265H |
Product Overview : | Human BMP3 partial ORF ( NP_001192, 373 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP3 bone morphogenetic protein 3 [ Homo sapiens ] |
Official Symbol | BMP3 |
Synonyms | BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A; |
Gene ID | 651 |
mRNA Refseq | NM_001201 |
Protein Refseq | NP_001192 |
MIM | 112263 |
UniProt ID | P12645 |
◆ Recombinant Proteins | ||
BMP3-655R | Recombinant Rat BMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bmp3-450M | Recombinant Mouse Bmp3 Protein, MYC/DDK-tagged | +Inquiry |
BMP3-1724HF | Recombinant Full Length Human BMP3 Protein, GST-tagged | +Inquiry |
Bmp3-2599M | Recombinant Mouse Bmp3 protein, Myc-tagged | +Inquiry |
BMP3-997R | Recombinant Rat BMP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *