Recombinant Human BMP4 Protein
Cat.No. : | BMP4-03H |
Product Overview : | Recombinant BMP-4 (293-408 aa) protein without tag was expressed as insoluble protein aggregate in E. coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 117 aa |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers. |
Form : | Liquid |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 85% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 10 mM Sodium Citrate buffer (pH 3.5) containing 10% glycerol |
Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ] |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; ZYME; BMP2B; OFC11; BMP2B1; MCOPS6; bone morphogenetic protein 4; bone morphogenetic protein 2B |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-013H | Active Recombinant Human BMP4 Protein | +Inquiry |
BMP4-1164HFL | Recombinant Full Length Human BMP4 Protein, C-His-tagged | +Inquiry |
BMP4-262H | Recombinant Human BMP4 protein, His-tagged | +Inquiry |
Bmp4-578TM | Recombinant Murine BMP4 | +Inquiry |
BMP4-04H | Active Recombinant Human BMP4 Protein, Animal Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *