Recombinant Human BMP4 protein, His-SUMO-tagged
| Cat.No. : | BMP4-2600H |
| Product Overview : | Recombinant Human BMP4 protein(P12644)(293-408aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 293-408aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens ] |
| Official Symbol | BMP4 |
| Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
| Gene ID | 652 |
| mRNA Refseq | NM_001202 |
| Protein Refseq | NP_001193 |
| MIM | 112262 |
| UniProt ID | P12644 |
| ◆ Recombinant Proteins | ||
| BMP4-13H | Recombinant Active Human BMP4 Protein, His-tagged(C-ter) | +Inquiry |
| BMP4-11H | Active Recombinant Human BMP4 Protein, Pre-aliquoted | +Inquiry |
| BMP4-24H | Recombinant Human BMP4 Protein, Ser293-Arg408 | +Inquiry |
| Bmp4-324M | Recombinant Mouse Bmp4 Protein, His-tagged | +Inquiry |
| BMP4-1132B | Active Recombinant Bovine BMP4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
| BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
