Recombinant Human BMP6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BMP6-5977H |
Product Overview : | BMP6 MS Standard C13 and N15-labeled recombinant protein (NP_001709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. |
Molecular Mass : | 57 kDa |
AA Sequence : | MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BMP6 bone morphogenetic protein 6 [ Homo sapiens (human) ] |
Official Symbol | BMP6 |
Synonyms | BMP6; bone morphogenetic protein 6; vegetal related growth factor (TGFB related), VGR; VGR1; BMP-6; VGR-1; VG-1-R; VG-1-related protein; Vg1-related sequence; vegetal-related (TGFB related) cytokine; vegetal related growth factor (TGFB-related); VGR; |
Gene ID | 654 |
mRNA Refseq | NM_001718 |
Protein Refseq | NP_001709 |
MIM | 112266 |
UniProt ID | P22004 |
◆ Recombinant Proteins | ||
BMP6-4368H | Recombinant Human BMP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bmp6-28M | Active Recombinant Mouse Bmp6 | +Inquiry |
Bmp6-27M | Recombinant Mouse Bone Morphogenetic Protein 6 | +Inquiry |
BMP6-015H | Active Recombinant Human BMP6 Protein | +Inquiry |
BMP6-281H | Active Recombinant Human BMP6 Protein (Val397-His513), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP6-8430HCL | Recombinant Human BMP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP6 Products
Required fields are marked with *
My Review for All BMP6 Products
Required fields are marked with *
0
Inquiry Basket