"BMPR1A" Related Products

Recombinant Human BMPR1A Protein (177-532 aa), His-SUMO-tagged

Cat.No. : BMPR1A-361H
Product Overview : Recombinant Human BMPR1A Protein (177-532 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.
Description : On ligand binding, forms a receptor complex consisting of two type II and two type I transmbrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 56.6 kDa
Protein length : 177-532 aa
AA Sequence : KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name : BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ]
Official Symbol : BMPR1A
Synonyms : BMPR1A; ACVRLK3; ALK3; CD292; ALK-3; BMPR-1A; SKR5; 10q23del;
Gene ID : 657
mRNA Refseq : NM_004329
Protein Refseq : NP_004320
MIM : 601299
UniProt ID : P36894

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.