Recombinant Human BMPR1A Protein (177-532 aa), His-SUMO-tagged
| Cat.No. : | BMPR1A-361H |
| Product Overview : | Recombinant Human BMPR1A Protein (177-532 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 177-532 aa |
| Description : | On ligand binding, forms a receptor complex consisting of two type II and two type I transmbrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 56.6 kDa |
| AA Sequence : | KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ] |
| Official Symbol | BMPR1A |
| Synonyms | BMPR1A; ACVRLK3; ALK3; CD292; ALK-3; BMPR-1A; SKR5; 10q23del; |
| Gene ID | 657 |
| mRNA Refseq | NM_004329 |
| Protein Refseq | NP_004320 |
| MIM | 601299 |
| UniProt ID | P36894 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR1A Products
Required fields are marked with *
My Review for All BMPR1A Products
Required fields are marked with *




