Recombinant Human BMPR1B protein, GST-tagged
Cat.No. : | BMPR1B-320H |
Product Overview : | Recombinant Human BMPR1B protein(NP_001194)(16-57 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 16-57 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ] |
Official Symbol | BMPR1B |
Synonyms | BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6; |
Gene ID | 658 |
mRNA Refseq | NM_001203 |
Protein Refseq | NP_001194 |
MIM | 603248 |
UniProt ID | O00238 |
◆ Recombinant Proteins | ||
Bmpr1b-820M | Recombinant Mouse Bmpr1b protein(Lys14-Lys126), hFc-tagged | +Inquiry |
BMPR1B-283H | Recombinant Human BMPR1B Protein, GST-tagged | +Inquiry |
BMPR1B-889H | Active Recombinant Human BMPR1B Protein, Fc Chimera | +Inquiry |
BMPR1B-282H | Active Recombinant Human BMPR1B Protein | +Inquiry |
RFL31494HF | Recombinant Full Length Human Bone Morphogenetic Protein Receptor Type-1B(Bmpr1B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR1B Products
Required fields are marked with *
My Review for All BMPR1B Products
Required fields are marked with *