Recombinant Human BMPR1B protein, GST-tagged
| Cat.No. : | BMPR1B-320H |
| Product Overview : | Recombinant Human BMPR1B protein(16-57 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 16-57 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ] |
| Official Symbol | BMPR1B |
| Synonyms | BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6; |
| Gene ID | 658 |
| mRNA Refseq | NM_001203 |
| Protein Refseq | NP_001194 |
| MIM | 603248 |
| UniProt ID | O00238 |
| ◆ Recombinant Proteins | ||
| RFL10949MF | Recombinant Full Length Mouse Bone Morphogenetic Protein Receptor Type-1B(Bmpr1B) Protein, His-Tagged | +Inquiry |
| BMPR1B-6689C | Recombinant Chicken BMPR1B | +Inquiry |
| BMPR1B-8534H | Recombinant Human BMPR1B, Fc tagged | +Inquiry |
| BMPR1B-5115H | Recombinant Human BMPR1B Protein (Met1-Arg126), C-His tagged | +Inquiry |
| BMPR1B-223H | Active Recombinant Human BMPR1B Protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
| BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR1B Products
Required fields are marked with *
My Review for All BMPR1B Products
Required fields are marked with *
