Recombinant Human BMPR2 protein(741-870 aa), C-His-tagged

Cat.No. : BMPR2-2863H
Product Overview : Recombinant Human BMPR2 protein(Q13873)(741-870 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 741-870 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGEDTRLNINSSPDEHEPL
Gene Name BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ]
Official Symbol BMPR2
Synonyms BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945;
Gene ID 659
mRNA Refseq NM_001204
Protein Refseq NP_001195
MIM 600799
UniProt ID Q13873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMPR2 Products

Required fields are marked with *

My Review for All BMPR2 Products

Required fields are marked with *

0
cart-icon