Recombinant Human BNP Protein

Cat.No. : BNP-08H
Product Overview : Recombinant Human BNP Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 32 amino acids
Description : Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data Not Available.
Molecular Mass : 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Endotoxin : Less than 1 EU/μg of rHuCNTF as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Official Symbol BNP
Synonyms Brain Natriuretic Peptide; BNP

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BNP Products

Required fields are marked with *

My Review for All BNP Products

Required fields are marked with *

0
cart-icon
0
compare icon