Species : |
Human |
Source : |
E.coli |
Protein Length : |
32 amino acids |
Description : |
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Data Not Available. |
Molecular Mass : |
3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids. |
AA Sequence : |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Endotoxin : |
Less than 1 EU/μg of rHuCNTF as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |