| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Description : |
CDON (MIM 608707) and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail. |
| Form : |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : |
17.3 kDa |
| AA Sequence : |
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS |
| Usage : |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : |
Best use within three months from the date of receipt of this protein. |
| Storage : |
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |