Recombinant Human BOC Protein

Cat.No. : BOC-296H
Product Overview : Human BOC full-length ORF (ADZ15974.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : CDON (MIM 608707) and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 17.3 kDa
AA Sequence : MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name BOC Boc homolog (mouse) [ Homo sapiens ]
Official Symbol BOC
Synonyms BOC
Gene ID 91653
mRNA Refseq NM_033254.2
Protein Refseq NP_150279.1
MIM 608708
UniProt ID Q9BWV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BOC Products

Required fields are marked with *

My Review for All BOC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon