Recombinant Human BOLA1 Protein (1-137 aa), His-tagged
| Cat.No. : | BOLA1-1343H |
| Product Overview : | Recombinant Human BOLA1 Protein (1-137 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-137 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 16.3 kDa |
| AA Sequence : | MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ] |
| Official Symbol | BOLA1 |
| Synonyms | BOLA1; CGI 143; hBolA; CGI-143; MGC75015; RP11-196G18.18; |
| Gene ID | 51027 |
| mRNA Refseq | NM_016074 |
| Protein Refseq | NP_057158 |
| MIM | 613181 |
| UniProt ID | Q9Y3E2 |
| ◆ Recombinant Proteins | ||
| BOLA1-7129H | Recombinant Human BOLA1, His-tagged | +Inquiry |
| BOLA1-380R | Recombinant Rhesus Macaque BOLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA1-1066M | Recombinant Mouse BOLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA1-300H | Recombinant Human BOLA1 Protein, GST-tagged | +Inquiry |
| BOLA1-3067H | Recombinant Human BOLA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOLA1 Products
Required fields are marked with *
My Review for All BOLA1 Products
Required fields are marked with *
