Recombinant Human BOLA1 Protein, GST-tagged
| Cat.No. : | BOLA1-300H |
| Product Overview : | Human BOLA1 full-length ORF ( NP_057158.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ] |
| Official Symbol | BOLA1 |
| Synonyms | BOLA1; bolA homolog 1 (E. coli); bolA like 1 (E. coli); bolA-like protein 1; CGI 143; bolA-like 1; hBolA; CGI-143; MGC75015; RP11-196G18.18; |
| Gene ID | 51027 |
| mRNA Refseq | NM_016074 |
| Protein Refseq | NP_057158 |
| MIM | 613181 |
| UniProt ID | Q9Y3E2 |
| ◆ Recombinant Proteins | ||
| BOLA1-380R | Recombinant Rhesus Macaque BOLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA1-3067H | Recombinant Human BOLA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BOLA1-300H | Recombinant Human BOLA1 Protein, GST-tagged | +Inquiry |
| BOLA1-10267H | Recombinant Human BOLA1, His-tagged | +Inquiry |
| BOLA1-230H | Recombinant Human BOLA1 protein(Met1-Pro137), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOLA1 Products
Required fields are marked with *
My Review for All BOLA1 Products
Required fields are marked with *
