Recombinant Human BOLA1 Protein, GST-tagged

• Cat.No.: BOLA1-300H
• Product Overview: Human BOLA1 full-length ORF ( NP_057158.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 40.7 kDa
• AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ]
• Official Symbol: BOLA1
• Synonyms: BOLA1; bolA homolog 1 (E. coli); bolA like 1 (E. coli); bolA-like protein 1; CGI 143; bolA-like 1; hBolA; CGI-143; MGC75015; RP11-196G18.18
• Gene ID: 51027
• mRNA Refseq: NM_016074
• Protein Refseq: NP_057158
• MIM: 613181
• UniProt ID: Q9Y3E2