Recombinant Human BOLA2 Protein, GST-tagged

Cat.No. : BOLA2-302H
Product Overview : Human BOLA2 full-length ORF ( ADR83317.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is located within a region of a segmental duplication on chromosome 16p. The product of this gene belongs to the eukaryotic subfamily of the BolA-like proteins. This gene encodes the BolA-like protein 2. The BolA-like proteins are widely conserved from prokaryotes to eukaryotes, and these proteins seem to be involved in cell proliferation or cell-cycle regulation.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 13.7 kDa
AA Sequence : MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRFCTE
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOLA2 bolA family member 2 [ Homo sapiens (human) ]
Official Symbol BOLA2
Synonyms My016; BOLA2A; BOLA2B
Gene ID 552900
mRNA Refseq NM_001031827.1
Protein Refseq NP_001026997.1
MIM 613182
UniProt ID Q9H3K6.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BOLA2 Products

Required fields are marked with *

My Review for All BOLA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon