Recombinant Human BOLA2 Protein, GST-tagged
| Cat.No. : | BOLA2-302H |
| Product Overview : | Human BOLA2 full-length ORF ( ADR83317.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is located within a region of a segmental duplication on chromosome 16p. The product of this gene belongs to the eukaryotic subfamily of the BolA-like proteins. This gene encodes the BolA-like protein 2. The BolA-like proteins are widely conserved from prokaryotes to eukaryotes, and these proteins seem to be involved in cell proliferation or cell-cycle regulation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 13.7 kDa |
| AA Sequence : | MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRFCTE |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BOLA2 bolA family member 2 [ Homo sapiens (human) ] |
| Official Symbol | BOLA2 |
| Synonyms | My016; BOLA2A; BOLA2B |
| Gene ID | 552900 |
| mRNA Refseq | NM_001031827.1 |
| Protein Refseq | NP_001026997.1 |
| MIM | 613182 |
| UniProt ID | Q9H3K6.1 |
| ◆ Recombinant Proteins | ||
| BOLA2-381R | Recombinant Rhesus Macaque BOLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA2-302H | Recombinant Human BOLA2 Protein, GST-tagged | +Inquiry |
| BOLA2-2454M | Recombinant Mouse BOLA2 Protein | +Inquiry |
| BOLA2-1067M | Recombinant Mouse BOLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA2-553R | Recombinant Rhesus monkey BOLA2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOLA2 Products
Required fields are marked with *
My Review for All BOLA2 Products
Required fields are marked with *
