Recombinant Human BOLA3 Protein, GST-tagged
| Cat.No. : | BOLA3-304H |
| Product Overview : | Human BOLA3 full-length ORF ( AAH42036.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 33.8 kDa |
| AA Sequence : | MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BOLA3 bolA homolog 3 (E. coli) [ Homo sapiens ] |
| Official Symbol | BOLA3 |
| Synonyms | bolA homolog 3 (E. coli); bolA-like 3 (E. coli); MMDS2; bolA-like protein 3; BOLA3 |
| Gene ID | 388962 |
| mRNA Refseq | NM_212552.2 |
| Protein Refseq | NP_997717.2 |
| MIM | 613183 |
| UniProt ID | Q53S33 |
| ◆ Recombinant Proteins | ||
| BOLA3-3766HF | Recombinant Full Length Human BOLA3 Protein, GST-tagged | +Inquiry |
| BOLA3-10268H | Recombinant Human BOLA3, GST-tagged | +Inquiry |
| BOLA3-382R | Recombinant Rhesus Macaque BOLA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BOLA3-554R | Recombinant Rhesus monkey BOLA3 Protein, His-tagged | +Inquiry |
| BOLA3-88H | Recombinant Human BOLA3, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOLA3 Products
Required fields are marked with *
My Review for All BOLA3 Products
Required fields are marked with *
