Recombinant Human BOLA3 Protein, GST-tagged

• Cat.No.: BOLA3-304H
• Product Overview: Human BOLA3 full-length ORF ( AAH42036.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 33.8 kDa
• AA Sequence: MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOLA3 bolA homolog 3 (E. coli) [ Homo sapiens ]
• Official Symbol: BOLA3
• Synonyms: bolA homolog 3 (E. coli); bolA-like 3 (E. coli); MMDS2; bolA-like protein 3; BOLA3
• Gene ID: 388962
• mRNA Refseq: NM_212552.2
• Protein Refseq: NP_997717.2
• MIM: 613183
• UniProt ID: Q53S33