Recombinant Full Length Human BOLA3 Protein, GST-tagged

Cat.No. : BOLA3-3766HF
Product Overview : Human BOLA3 full-length ORF ( AAH42036.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 68 amino acids
Description : This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentration gradient between serum and peripheral tissues. The encoded protein catalyzes the last step in estrogen activation, using NADPH to convert estrogens E1 and E2 and androgens like 4-androstenedione, to testosterone. It has an N-terminal short-chain dehydrogenase domain with a cofactor binding site, and a narrow, hydrophobic C-terminal domain with a steroid substrate binding site. This gene is expressed primarily in the placenta and ovarian granulosa cells, and to a lesser extent, in the endometrium, adipose tissue, and prostate. Polymorphisms in this gene have been linked to breast and prostate cancer. A pseudogene of this gene has been identified. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.8 kDa
AA Sequence : MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOLA3 bolA homolog 3 (E. coli) [ Homo sapiens ]
Official Symbol BOLA3
Synonyms bolA homolog 3 (E. coli); bolA-like 3 (E. coli); MMDS2; bolA-like protein 3; BOLA3
Gene ID 388962
mRNA Refseq NM_212552.2
Protein Refseq NP_997717.2
MIM 613183
UniProt ID Q53S33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BOLA3 Products

Required fields are marked with *

My Review for All BOLA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon