Recombinant Full Length Human BOLA3 Protein, GST-tagged
Cat.No. : | BOLA3-3766HF |
Product Overview : | Human BOLA3 full-length ORF ( AAH42036.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 68 amino acids |
Description : | This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentration gradient between serum and peripheral tissues. The encoded protein catalyzes the last step in estrogen activation, using NADPH to convert estrogens E1 and E2 and androgens like 4-androstenedione, to testosterone. It has an N-terminal short-chain dehydrogenase domain with a cofactor binding site, and a narrow, hydrophobic C-terminal domain with a steroid substrate binding site. This gene is expressed primarily in the placenta and ovarian granulosa cells, and to a lesser extent, in the endometrium, adipose tissue, and prostate. Polymorphisms in this gene have been linked to breast and prostate cancer. A pseudogene of this gene has been identified. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOLA3 bolA homolog 3 (E. coli) [ Homo sapiens ] |
Official Symbol | BOLA3 |
Synonyms | bolA homolog 3 (E. coli); bolA-like 3 (E. coli); MMDS2; bolA-like protein 3; BOLA3 |
Gene ID | 388962 |
mRNA Refseq | NM_212552.2 |
Protein Refseq | NP_997717.2 |
MIM | 613183 |
UniProt ID | Q53S33 |
◆ Recombinant Proteins | ||
BOLA3-10268H | Recombinant Human BOLA3, GST-tagged | +Inquiry |
BOLA3-554R | Recombinant Rhesus monkey BOLA3 Protein, His-tagged | +Inquiry |
BOLA3-3766HF | Recombinant Full Length Human BOLA3 Protein, GST-tagged | +Inquiry |
BOLA3-88H | Recombinant Human BOLA3, His-tagged | +Inquiry |
BOLA3-382R | Recombinant Rhesus Macaque BOLA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOLA3 Products
Required fields are marked with *
My Review for All BOLA3 Products
Required fields are marked with *
0
Inquiry Basket