Recombinant Human BOP1 Protein, GST-tagged
Cat.No. : | BOP1-308H |
Product Overview : | Human BOP1 full-length ORF ( NP_056016.1, 1 a.a. - 746 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 110 kDa |
AA Sequence : | MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRPADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFIQERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLSVSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVLLLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQVTWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQRSVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLRHHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLGVLDVIFHPTQPWVFSSGADGTVRLFT |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOP1 block of proliferation 1 [ Homo sapiens ] |
Official Symbol | BOP1 |
Synonyms | BOP1; block of proliferation 1; ribosome biogenesis protein BOP1; KIAA0124; block of proliferation 1 protein; |
Gene ID | 23246 |
mRNA Refseq | NM_015201 |
Protein Refseq | NP_056016 |
MIM | 610596 |
UniProt ID | Q14137 |
◆ Recombinant Proteins | ||
BOP1-2772H | Recombinant Human BOP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BOP1-1068M | Recombinant Mouse BOP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BOP1-4829Z | Recombinant Zebrafish BOP1 | +Inquiry |
BOP1-308H | Recombinant Human BOP1 Protein, GST-tagged | +Inquiry |
BOP1-661R | Recombinant Rat BOP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOP1-8418HCL | Recombinant Human BOP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOP1 Products
Required fields are marked with *
My Review for All BOP1 Products
Required fields are marked with *