Recombinant Human BOP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BOP1-2772H |
Product Overview : | BOP1 MS Standard C13 and N15-labeled recombinant protein (NP_056016) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome. |
Molecular Mass : | 83.6 kDa |
AA Sequence : | MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRPADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFIQERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLSVSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVLLLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQVTWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQRSVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLRHHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLGVLDVIFHPTQPWVFSSGADGTVRLFTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BOP1 block of proliferation 1 [ Homo sapiens (human) ] |
Official Symbol | BOP1 |
Synonyms | BOP1; block of proliferation 1; ribosome biogenesis protein BOP1; KIAA0124; block of proliferation 1 protein; |
Gene ID | 23246 |
mRNA Refseq | NM_015201 |
Protein Refseq | NP_056016 |
MIM | 610596 |
UniProt ID | Q14137 |
◆ Recombinant Proteins | ||
BOP1-2457M | Recombinant Mouse BOP1 Protein | +Inquiry |
BOP1-1003R | Recombinant Rat BOP1 Protein | +Inquiry |
BOP1-2772H | Recombinant Human BOP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bop1-719M | Recombinant Mouse Bop1 Protein, MYC/DDK-tagged | +Inquiry |
BOP1-4829Z | Recombinant Zebrafish BOP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOP1-8418HCL | Recombinant Human BOP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOP1 Products
Required fields are marked with *
My Review for All BOP1 Products
Required fields are marked with *
0
Inquiry Basket