Recombinant Human BORCS7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BORCS7-6043H
Product Overview : C10orf32 MS Standard C13 and N15-labeled recombinant protein (NP_653192) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : BORCS7 (BLOC-1 Related Complex Subunit 7) is a Protein Coding gene. Diseases associated with BORCS7 include Leopard Syndrome 1 and Breast Apocrine Carcinoma. An important paralog of this gene is BORCS7-ASMT.
Molecular Mass : 11.6 kDa
AA Sequence : MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BORCS7 BLOC-1 related complex subunit 7 [ Homo sapiens (human) ]
Official Symbol BORCS7
Synonyms BORCS7; BLOC-1 related complex subunit 7; C10orf32; FLJ40752; MGC27171; DKFZp686B2219; BLOC-1-related complex subunit 7; UPF0693 protein C10orf32; diaskedin
Gene ID 119032
mRNA Refseq NM_144591
Protein Refseq NP_653192
MIM 616600
UniProt ID Q96B45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BORCS7 Products

Required fields are marked with *

My Review for All BORCS7 Products

Required fields are marked with *

0
cart-icon
0
compare icon