Recombinant Human BPHL, His-tagged
| Cat.No. : | BPHL-27669TH |
| Product Overview : | Recombinant full length Human BPHL with N terminal His tag; 275 amino acids with tag, MWt 31.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 254 amino acids |
| Description : | This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described. |
| Conjugation : | HIS |
| Molecular Weight : | 31.100kDa inclusive of tags |
| Tissue specificity : | Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
| Sequence Similarities : | Belongs to the AB hydrolase superfamily. Lipase family. |
| Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] |
| Official Symbol | BPHL |
| Synonyms | BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; |
| Gene ID | 670 |
| mRNA Refseq | NM_004332 |
| Protein Refseq | NP_004323 |
| MIM | 603156 |
| Uniprot ID | Q86WA6 |
| Chromosome Location | 6p25 |
| Function | hydrolase activity; |
| ◆ Recombinant Proteins | ||
| BPHL-8330Z | Recombinant Zebrafish BPHL | +Inquiry |
| BPHL-8604H | Recombinant Human BPHL, His tagged | +Inquiry |
| BPHL-2772H | Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged | +Inquiry |
| BPHL-10272H | Recombinant Human BPHL, His-tagged | +Inquiry |
| BPHL-311H | Recombinant Human BPHL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *



