Recombinant Human BPHL Protein, GST-tagged
Cat.No. : | BPHL-311H |
Product Overview : | Human BPHL full-length ORF ( NP_004323.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] |
Official Symbol | BPHL |
Synonyms | BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930; |
Gene ID | 670 |
mRNA Refseq | NM_004332 |
Protein Refseq | NP_004323 |
MIM | 603156 |
UniProt ID | Q86WA6 |
◆ Recombinant Proteins | ||
BPHL-4596H | Recombinant Human BPHL protein, His-SUMO-tagged | +Inquiry |
BPHL-2772H | Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged | +Inquiry |
BPHL-10272H | Recombinant Human BPHL, His-tagged | +Inquiry |
BPHL-311H | Recombinant Human BPHL Protein, GST-tagged | +Inquiry |
BPHL-27669TH | Recombinant Human BPHL, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *