Recombinant Human BPHL Protein, GST-tagged

Cat.No. : BPHL-311H
Product Overview : Human BPHL full-length ORF ( NP_004323.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 57.5 kDa
AA Sequence : MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
Official Symbol BPHL
Synonyms BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930;
Gene ID 670
mRNA Refseq NM_004332
Protein Refseq NP_004323
MIM 603156
UniProt ID Q86WA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPHL Products

Required fields are marked with *

My Review for All BPHL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon