Recombinant Human BPHL Protein, GST-tagged

• Cat.No.: BPHL-311H
• Product Overview: Human BPHL full-length ORF ( NP_004323.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 57.5 kDa
• AA Sequence: MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
• Official Symbol: BPHL
• Synonyms: BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930
• Gene ID: 670
• mRNA Refseq: NM_004332
• Protein Refseq: NP_004323
• MIM: 603156
• UniProt ID: Q86WA6