Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged
Cat.No. : | BPHL-2772H |
Product Overview : | Recombinant Human BPHL Protein (38-291 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 38-291 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.8 kDa |
AA Sequence : | SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] |
Official Symbol | BPHL |
Synonyms | BPHL; MCNAA; valacyclovir hydrolase; Bph rp; valacyclovirase; BPH-RP; VACVASE; MGC41865; MGC125930; |
Gene ID | 670 |
mRNA Refseq | NM_004332 |
Protein Refseq | NP_004323 |
MIM | 603156 |
UniProt ID | Q86WA6 |
◆ Recombinant Proteins | ||
BPHL-2460M | Recombinant Mouse BPHL Protein | +Inquiry |
BPHL-8330Z | Recombinant Zebrafish BPHL | +Inquiry |
BPHL-2772H | Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged | +Inquiry |
BPHL-10272H | Recombinant Human BPHL, His-tagged | +Inquiry |
BPHL-27669TH | Recombinant Human BPHL, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *
0
Inquiry Basket