Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged

• Cat.No.: BPHL-2772H
• Product Overview: Recombinant Human BPHL Protein (38-291 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 38-291 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.8 kDa
• AA Sequence: SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
• Official Symbol: BPHL
• Synonyms: BPHL; MCNAA; valacyclovir hydrolase; Bph rp; valacyclovirase; BPH-RP; VACVASE; MGC41865; MGC125930
• Gene ID: 670
• mRNA Refseq: NM_004332
• Protein Refseq: NP_004323
• MIM: 603156
• UniProt ID: Q86WA6