Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged
| Cat.No. : | BPHL-2772H | 
| Product Overview : | Recombinant Human BPHL Protein (38-291 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Insect Cells | 
| Tag : | His&Myc | 
| Protein Length : | 38-291 aa | 
| Form : | Tris-based buffer,50% glycerol | 
| Molecular Mass : | 32.8 kDa | 
| AA Sequence : | SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ | 
| Purity : | > 85% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. | 
| Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] | 
| Official Symbol | BPHL | 
| Synonyms | BPHL; MCNAA; valacyclovir hydrolase; Bph rp; valacyclovirase; BPH-RP; VACVASE; MGC41865; MGC125930; | 
| Gene ID | 670 | 
| mRNA Refseq | NM_004332 | 
| Protein Refseq | NP_004323 | 
| MIM | 603156 | 
| UniProt ID | Q86WA6 | 
| ◆ Recombinant Proteins | ||
| BPHL-2772H | Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged | +Inquiry | 
| BPHL-4596H | Recombinant Human BPHL protein, His-SUMO-tagged | +Inquiry | 
| BPHL-1071M | Recombinant Mouse BPHL Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BPHL-3450H | Recombinant Human BPHL protein, His-tagged | +Inquiry | 
| BPHL-311H | Recombinant Human BPHL Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            