Recombinant Human BPIFA1 protein, His-tagged
| Cat.No. : | BPIFA1-2142H |
| Product Overview : | Recombinant Human BPIFA1 protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-256 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BPIFA1 BPI fold containing family A, member 1 [ Homo sapiens ] |
| Official Symbol | BPIFA1 |
| Synonyms | BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606 |
| Gene ID | 51297 |
| mRNA Refseq | NM_130852 |
| Protein Refseq | NP_057667 |
| MIM | 607412 |
| UniProt ID | Q9NP55 |
| ◆ Recombinant Proteins | ||
| BPIFA1-2787H | Recombinant Human BPIFA1 Protein, MYC/DDK-tagged | +Inquiry |
| BPIFA1-2084H | Recombinant Human BPIFA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BPIFA1-454H | Recombinant Human BPIFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BPIFA1-989HFL | Recombinant Full Length Human BPIFA1 Protein, C-Flag-tagged | +Inquiry |
| BPIFA1-1727H | Recombinant Human BPIFA1 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA1 Products
Required fields are marked with *
My Review for All BPIFA1 Products
Required fields are marked with *



