Recombinant Human BPIFA1 protein, His-tagged

• Cat.No.: BPIFA1-2142H
• Product Overview: Recombinant Human BPIFA1 protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-256 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: BPIFA1 BPI fold containing family A, member 1 [ Homo sapiens ]
• Official Symbol: BPIFA1
• Synonyms: BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606
• Gene ID: 51297
• mRNA Refseq: NM_130852
• Protein Refseq: NP_057667
• MIM: 607412
• UniProt ID: Q9NP55