Recombinant Full Length Human BPIFA1 Protein, C-Flag-tagged
Cat.No. : | BPIFA1-989HFL |
Product Overview : | Recombinant Full Length Human BPIFA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | BPIFA1 BPI fold containing family A member 1 [ Homo sapiens (human) ] |
Official Symbol | BPIFA1 |
Synonyms | LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5 |
Gene ID | 51297 |
mRNA Refseq | NM_016583.4 |
Protein Refseq | NP_057667.1 |
MIM | 607412 |
UniProt ID | Q9NP55 |
◆ Recombinant Proteins | ||
BPIFA1-454H | Recombinant Human BPIFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BPIFA1-2787H | Recombinant Human BPIFA1 Protein, MYC/DDK-tagged | +Inquiry |
BPIFA1-664R | Recombinant Rat BPIFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BPIFA1-2463H | Recombinant Human BPIFA1 protein, His-SUMO-tagged | +Inquiry |
BPIFA1-746H | Recombinant Human BPIFA1 Protein, His/GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA1 Products
Required fields are marked with *
My Review for All BPIFA1 Products
Required fields are marked with *