Recombinant Human BPIFA2 Protein (14-249 aa)
Cat.No. : | BPIFA2-2264H |
Product Overview : | Recombinant Human BPIFA2 Protein (14-249 aa) is produced by Yeast expression system. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Protein Length : | 14-249 aa |
Description : | Has strong antibacterial activity against P. aeruginosa. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.1 kDa |
AA Sequence : | ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ] |
Official Symbol | BPIFA2 |
Synonyms | BPIFA2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; C20orf70; |
Gene ID | 140683 |
mRNA Refseq | NM_080574 |
Protein Refseq | NP_542141 |
UniProt ID | Q96DR5 |
◆ Recombinant Proteins | ||
BPIFA2-385R | Recombinant Rhesus Macaque BPIFA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BPIFA2-5806H | Recombinant Human BPIFA2 protein | +Inquiry |
BPIFA2-5805H | Recombinant Human BPIFA2 protein, His-sumostar-tagged | +Inquiry |
BPIFA2-2264H | Recombinant Human BPIFA2 Protein (14-249 aa) | +Inquiry |
BPIFA2-3134H | Recombinant Human BPIFA2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
BPIFA2-1459HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA2 Products
Required fields are marked with *
My Review for All BPIFA2 Products
Required fields are marked with *