Recombinant Human BPIFA2 protein
Cat.No. : | BPIFA2-2450H |
Product Overview : | Recombinant Human BPIFA2 protein(Q96DR5)(19-249aa), fused to Tag-Free, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 19-249aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ] |
Official Symbol | BPIFA2 |
Synonyms | BPIFA2; BPI fold containing family A, member 2; C20orf70, chromosome 20 open reading frame 70; BPI fold-containing family A member 2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; short palate, lung and nasal epithelium carcinoma associated 2; short palate, lung and nasal epithelium carcinoma-associated protein 2; C20orf70; |
Gene ID | 140683 |
mRNA Refseq | NM_080574 |
Protein Refseq | NP_542141 |
UniProt ID | Q96DR5 |
◆ Recombinant Proteins | ||
BPIFA2-2254H | Recombinant Human BPIFA2 Protein (14-249 aa), His-SUMOSTAR-tagged | +Inquiry |
BPIFA2-7381H | Recombinant Human BPIFA2 protein(Met1-Ile249), hFc-tagged | +Inquiry |
BPIFA2-385R | Recombinant Rhesus Macaque BPIFA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BPIFA2-8619H | Recombinant Human BPIFA2 protein(Met1-Ile249), His-tagged | +Inquiry |
BPIFA2-2463M | Recombinant Mouse BPIFA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
BPIFA2-1459HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA2 Products
Required fields are marked with *
My Review for All BPIFA2 Products
Required fields are marked with *