Recombinant Human BPIFA2 protein

Cat.No. : BPIFA2-2450H
Product Overview : Recombinant Human BPIFA2 protein(Q96DR5)(19-249aa), fused to Tag-Free, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 19-249aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.1 kDa
AA Sequence : ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ]
Official Symbol BPIFA2
Synonyms BPIFA2; BPI fold containing family A, member 2; C20orf70, chromosome 20 open reading frame 70; BPI fold-containing family A member 2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; short palate, lung and nasal epithelium carcinoma associated 2; short palate, lung and nasal epithelium carcinoma-associated protein 2; C20orf70;
Gene ID 140683
mRNA Refseq NM_080574
Protein Refseq NP_542141
UniProt ID Q96DR5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPIFA2 Products

Required fields are marked with *

My Review for All BPIFA2 Products

Required fields are marked with *

0
cart-icon