Recombinant Human BPTF protein(459-657 aa), GST-tagged
| Cat.No. : | BPTF-20H |
| Product Overview : | Recombinant Human BPTF protein(459-657 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 459-657 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | BPTF bromodomain PHD finger transcription factor [ Homo sapiens ] |
| Official Symbol | BPTF |
| Synonyms | BPTF; bromodomain PHD finger transcription factor; FALZ, fetal Alzheimer antigen; nucleosome-remodeling factor subunit BPTF; FAC1; NURF301; fetal Alzheimer antigen; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; nucleosome remodeling factor, large subunit; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; FALZ; |
| Gene ID | 2186 |
| mRNA Refseq | NM_004459 |
| Protein Refseq | NP_004450 |
| MIM | 601819 |
| UniProt ID | Q12830 |
| ◆ Recombinant Proteins | ||
| BPTF-14H | Recombinant Human BPTF Protein, GST-tagged | +Inquiry |
| BPTF-3522H | Recombinant Human BPTF protein, GST-tagged | +Inquiry |
| BPTF-80H | Recombinant Human BPTF protein, GST-tagged | +Inquiry |
| BPTF-82H | Recombinant Human BPTF protein, GST-tagged | +Inquiry |
| BPTF-83H | Recombinant Human BPTF protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPTF Products
Required fields are marked with *
My Review for All BPTF Products
Required fields are marked with *
