Recombinant Human BPTF protein(459-657 aa), GST-tagged

Cat.No. : BPTF-20H
Product Overview : Recombinant Human BPTF protein(459-657 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 459-657 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name BPTF bromodomain PHD finger transcription factor [ Homo sapiens ]
Official Symbol BPTF
Synonyms BPTF; bromodomain PHD finger transcription factor; FALZ, fetal Alzheimer antigen; nucleosome-remodeling factor subunit BPTF; FAC1; NURF301; fetal Alzheimer antigen; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; nucleosome remodeling factor, large subunit; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; FALZ;
Gene ID 2186
mRNA Refseq NM_004459
Protein Refseq NP_004450
MIM 601819
UniProt ID Q12830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPTF Products

Required fields are marked with *

My Review for All BPTF Products

Required fields are marked with *

0
cart-icon