Recombinant Human BPTF protein(459-657 aa), GST-tagged

• Cat.No.: BPTF-20H
• Product Overview: Recombinant Human BPTF protein(459-657 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 459-657 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: BPTF bromodomain PHD finger transcription factor [ Homo sapiens ]
• Official Symbol: BPTF
• Synonyms: BPTF; bromodomain PHD finger transcription factor; FALZ, fetal Alzheimer antigen; nucleosome-remodeling factor subunit BPTF; FAC1; NURF301; fetal Alzheimer antigen; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; nucleosome remodeling factor, large subunit; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; FALZ
• Gene ID: 2186
• mRNA Refseq: NM_004459
• Protein Refseq: NP_004450
• MIM: 601819
• UniProt ID: Q12830