Recombinant Human BPTF protein, GST-tagged

Cat.No. : BPTF-3522H
Product Overview : Recombinant Human BPTF protein(459-657 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 459-657 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name BPTF bromodomain PHD finger transcription factor [ Homo sapiens ]
Official Symbol BPTF
Synonyms BPTF; bromodomain PHD finger transcription factor; FALZ, fetal Alzheimer antigen; nucleosome-remodeling factor subunit BPTF; FAC1; NURF301; fetal Alzheimer antigen; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; nucleosome remodeling factor, large subunit; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; FALZ;
Gene ID 2186
mRNA Refseq NM_004459
Protein Refseq NP_004450
MIM 601819
UniProt ID Q12830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPTF Products

Required fields are marked with *

My Review for All BPTF Products

Required fields are marked with *

0
cart-icon
0
compare icon