Recombinant Human BPTF protein, GST-tagged
Cat.No. : | BPTF-3522H |
Product Overview : | Recombinant Human BPTF protein(459-657 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 459-657 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BPTF bromodomain PHD finger transcription factor [ Homo sapiens ] |
Official Symbol | BPTF |
Synonyms | BPTF; bromodomain PHD finger transcription factor; FALZ, fetal Alzheimer antigen; nucleosome-remodeling factor subunit BPTF; FAC1; NURF301; fetal Alzheimer antigen; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; nucleosome remodeling factor, large subunit; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; FALZ; |
Gene ID | 2186 |
mRNA Refseq | NM_004459 |
Protein Refseq | NP_004450 |
MIM | 601819 |
UniProt ID | Q12830 |
◆ Recombinant Proteins | ||
BPTF-83H | Recombinant Human BPTF protein, His-tagged | +Inquiry |
BPTF-3522H | Recombinant Human BPTF protein, GST-tagged | +Inquiry |
BPTF-81H | Recombinant Human BPTF protein, His-tagged | +Inquiry |
BPTF-1017H | Recombinant Human BPTF Protein (D2865-A3033), Tag Free | +Inquiry |
BPTF-21H | Recombinant Human BPTF protein(361-880 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPTF Products
Required fields are marked with *
My Review for All BPTF Products
Required fields are marked with *
0
Inquiry Basket