Recombinant Human BRAP protein, His-tagged
Cat.No. : | BRAP-4242H |
Product Overview : | Recombinant Human BRAP protein(Q7Z569)(2-262aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-262a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKGGGGSGGGGSEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPLE |
Gene Name | BRAP BRCA1 associated protein [ Homo sapiens ] |
Official Symbol | BRAP |
Synonyms | BRAP; BRCA1 associated protein; BRCA1-associated protein; BRAP2; galectin 2 binding protein; IMP; impedes mitogenic signal propagation; RNF52; RING finger protein 52; galectin-2-binding protein; renal carcinoma antigen NY-REN-63; |
Gene ID | 8315 |
mRNA Refseq | NM_006768 |
Protein Refseq | NP_006759 |
MIM | 604986 |
UniProt ID | Q7Z569 |
◆ Recombinant Proteins | ||
BRAP-637H | Recombinant Human BRAP Protein, His-tagged | +Inquiry |
BRAP-561R | Recombinant Rhesus monkey BRAP Protein, His-tagged | +Inquiry |
BRAP-1082M | Recombinant Mouse BRAP Protein, His (Fc)-Avi-tagged | +Inquiry |
BRAP-0724H | Recombinant Human BRAP Protein (S2-K592), His tagged | +Inquiry |
BRAP-2478M | Recombinant Mouse BRAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRAP-8413HCL | Recombinant Human BRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRAP Products
Required fields are marked with *
My Review for All BRAP Products
Required fields are marked with *
0
Inquiry Basket