Recombinant Human BRD4 protein(150-200aa), His-GST-tagged
Cat.No. : | BRD4-377H |
Product Overview : | Recombinant Human BRD4 protein(O60885)(150-200aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 150-200aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTT |
Gene Name | BRD4 bromodomain containing 4 [ Homo sapiens ] |
Official Symbol | BRD4 |
Synonyms | BRD4; bromodomain containing 4; bromodomain-containing protein 4; CAP; chromosome associated protein; HUNK1; HUNKI; MCAP; bromodomain-containing 4; chromosome-associated protein; |
Gene ID | 23476 |
mRNA Refseq | NM_014299 |
Protein Refseq | NP_055114 |
MIM | 608749 |
UniProt ID | O60885 |
◆ Recombinant Proteins | ||
BRD4-1904H | Recombinant Human BRD4, GST-tagged | +Inquiry |
BRD4-3907H | Recombinant Human BRD4 protein, His-tagged | +Inquiry |
BRD4-158H | Recombinant Human BRD4, GST-tagged | +Inquiry |
BRD4-37H | Recombinant Human BRD4(Glu49-Glu460) Protein, N-10*His-Flag-tagged | +Inquiry |
BRD4-05H | Recombinant Human BRD4 Protein (44-460), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD4-179HCL | Recombinant Human BRD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRD4 Products
Required fields are marked with *
My Review for All BRD4 Products
Required fields are marked with *
0
Inquiry Basket