Recombinant Human BRD8 Protein, GST-tagged
Cat.No. : | BRD8-332H |
Product Overview : | Human BRD8 partial ORF ( NP_631938, 33 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRD8 bromodomain containing 8 [ Homo sapiens ] |
Official Symbol | BRD8 |
Synonyms | BRD8; bromodomain containing 8; bromodomain-containing protein 8; p120; SMAP; trCP120; skeletal muscle abundant protein 2; thyroid hormone receptor coactivating protein of 120 kDa; SMAP2; |
Gene ID | 10902 |
mRNA Refseq | NM_001164326 |
Protein Refseq | NP_001157798 |
MIM | 602848 |
UniProt ID | Q9H0E9 |
◆ Recombinant Proteins | ||
Brd8-456M | Recombinant Mouse Brd8 Protein, His-tagged | +Inquiry |
BRD8-2782H | Recombinant Human BRD8 Protein, MYC/DDK-tagged | +Inquiry |
BRD8-97H | Recombinant Human BRD8 protein, GST-tagged | +Inquiry |
BRD8-2396H | Recombinant Human BRD8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BRD8-98H | Recombinant Human BRD8 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRD8 Products
Required fields are marked with *
My Review for All BRD8 Products
Required fields are marked with *