Recombinant Human BRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BRK1-1039H
Product Overview : C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : BRK1 (BRICK1 Subunit Of SCAR/WAVE Actin Nucleating Complex) is a Protein Coding gene. Diseases associated with BRK1 include Cataract 40 and Spinocerebellar Ataxia, Autosomal Recessive 3. Among its related pathways are Signaling by GPCR and G-protein signaling RAC1 in cellular process. Gene Ontology (GO) annotations related to this gene include Rac GTPase binding.
Molecular Mass : 8.7 kDa
AA Sequence : MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BRK1 BRICK1 subunit of SCAR/WAVE actin nucleating complex [ Homo sapiens (human) ]
Official Symbol BRK1
Synonyms BRK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit; C3orf10, chromosome 3 open reading frame 10; protein BRICK1; BRICK1; SCAR/WAVE actin nucleating complex subunit; homolog (Arabidopsis thaliana); haematopoietic stem/progenitor cell protein 300; HSPC300; MDS027; probable protein BRICK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit, homolog; hHBrk1; C3orf10;
Gene ID 55845
mRNA Refseq NM_018462
Protein Refseq NP_060932
MIM 611183
UniProt ID Q8WUW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRK1 Products

Required fields are marked with *

My Review for All BRK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon