Recombinant Human BRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | BRK1-1039H |
| Product Overview : | C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | BRK1 (BRICK1 Subunit Of SCAR/WAVE Actin Nucleating Complex) is a Protein Coding gene. Diseases associated with BRK1 include Cataract 40 and Spinocerebellar Ataxia, Autosomal Recessive 3. Among its related pathways are Signaling by GPCR and G-protein signaling RAC1 in cellular process. Gene Ontology (GO) annotations related to this gene include Rac GTPase binding. |
| Molecular Mass : | 8.7 kDa |
| AA Sequence : | MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | BRK1 BRICK1 subunit of SCAR/WAVE actin nucleating complex [ Homo sapiens (human) ] |
| Official Symbol | BRK1 |
| Synonyms | BRK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit; C3orf10, chromosome 3 open reading frame 10; protein BRICK1; BRICK1; SCAR/WAVE actin nucleating complex subunit; homolog (Arabidopsis thaliana); haematopoietic stem/progenitor cell protein 300; HSPC300; MDS027; probable protein BRICK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit, homolog; hHBrk1; C3orf10; |
| Gene ID | 55845 |
| mRNA Refseq | NM_018462 |
| Protein Refseq | NP_060932 |
| MIM | 611183 |
| UniProt ID | Q8WUW1 |
| ◆ Recombinant Proteins | ||
| BRK1-5017H | Recombinant Human BRK1, His-tagged | +Inquiry |
| BRK1-416H | Recombinant Human BRICK1, SCAR/WAVE actin-nucleating complex subunit, His-tagged | +Inquiry |
| Brk1-178M | Recombinant Mouse Brk1 Protein, MYC/DDK-tagged | +Inquiry |
| BRK1-1039H | Recombinant Human BRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BRK1-8055HCL | Recombinant Human C3orf10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRK1 Products
Required fields are marked with *
My Review for All BRK1 Products
Required fields are marked with *
