Recombinant Human BRSK1, His-tagged
| Cat.No. : | BRSK1-27740TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 591-778 of Human BRSK1, with N terminal His tag, 188aa, 23kDa, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 591-778 a.a. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed, with highest levels in brain and testis. Protein levels remain constant throughout the cell cycle. |
| Form : | Lyophilised:reconstitution with 149 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSS EGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQ AQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGR PDPELSSSPRRGPPKDKKLLATNGTPLP |
| Sequence Similarities : | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.Contains 1 protein kinase domain.Contains 1 UBA domain. |
| Gene Name | BRSK1 BR serine/threonine kinase 1 [ Homo sapiens ] |
| Official Symbol | BRSK1 |
| Synonyms | BRSK1; BR serine/threonine kinase 1; serine/threonine-protein kinase BRSK1; KIAA1811; |
| Gene ID | 84446 |
| mRNA Refseq | NM_032430 |
| Protein Refseq | NP_115806 |
| MIM | 609235 |
| Uniprot ID | Q8TDC3 |
| Chromosome Location | 19q13.4 |
| Pathway | LKB1 signaling events, organism-specific biosystem; |
| Function | ATP binding; gamma-tubulin binding; magnesium ion binding; nucleotide binding; protein serine/threonine kinase activity; |
| ◆ Recombinant Proteins | ||
| BRSK1-1175H | Recombinant Human BRSK1 Protein (S2-P778), GST tagged | +Inquiry |
| BRSK1-7008HF | Active Recombinant Full Length Human BRSK1 Protein, GST-tagged | +Inquiry |
| BRSK1-1020R | Recombinant Rat BRSK1 Protein | +Inquiry |
| BRSK1-5370H | Recombinant Human BR Serine/Threonine Kinase 1, GST-tagged | +Inquiry |
| BRSK1-1369M | Active Recombinant Mouse BRSK1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRSK1 Products
Required fields are marked with *
My Review for All BRSK1 Products
Required fields are marked with *
