Recombinant Human BSG protein, His/Myc-tagged
| Cat.No. : | BSG-205H |
| Product Overview : | Recombinant Human BSG protein(138-323aa) was fused to His/Myc-tagged at C-terminus and expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&Myc |
| Protein Length : | Partial |
| Description : | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | BSG |
| Official Symbol | BSG |
| Synonyms | 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor |
| Gene ID | 682 |
| MIM | 109480 |
| UniProt ID | P35613 |
| ◆ Recombinant Proteins | ||
| BSG-606H | Active Recombinant Human CD147 Protein, His-tagged | +Inquiry |
| Bsg-612R | Recombinant Rat Bsg Protein, His-tagged | +Inquiry |
| BSG-680R | Recombinant Rat BSG Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSG-2041H | Recombinant Human BSG Protein, Fc/His-tagged | +Inquiry |
| RFL559RF | Recombinant Full Length Rat Basigin(Bsg) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
| BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *



