Recombinant Human BSG protein, His/Myc-tagged

• Cat.No.: BSG-205H
• Product Overview: Recombinant Human BSG protein(138-323aa) was fused to His/Myc-tagged at C-terminus and expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Myc
• Protein Length: Partial
• Description: The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.9 kDa
• AA Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: BSG
• Official Symbol: BSG
• Synonyms: 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor
• Gene ID: 682
• MIM: 109480
• UniProt ID: P35613