Recombinant Human BST1 protein, GST-tagged

• Cat.No.: BST1-10306H
• Product Overview: Recombinant Human BST1 protein(40-318 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 40-318 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: BST1
• Synonyms: BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2
• Gene ID: 683
• mRNA Refseq: NM_004334
• Protein Refseq: NP_004325
• MIM: 600387
• UniProt ID: Q10588