Recombinant Human BST1 protein, GST-tagged

Cat.No. : BST1-10306H
Product Overview : Recombinant Human BST1 protein(40-318 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability September 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 40-318 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol BST1
Synonyms BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2;
Gene ID 683
mRNA Refseq NM_004334
Protein Refseq NP_004325
MIM 600387
UniProt ID Q10588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BST1 Products

Required fields are marked with *

My Review for All BST1 Products

Required fields are marked with *

0
cart-icon