Recombinant Human BST1 protein, GST-tagged
Cat.No. : | BST1-10306H |
Product Overview : | Recombinant Human BST1 protein(40-318 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 40-318 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | BST1 |
Synonyms | BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; |
Gene ID | 683 |
mRNA Refseq | NM_004334 |
Protein Refseq | NP_004325 |
MIM | 600387 |
UniProt ID | Q10588 |
◆ Recombinant Proteins | ||
BST1-682R | Recombinant Rat BST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BST1-1647C | Recombinant Cynomolgus BST1 protein, His-tagged | +Inquiry |
BST1-2929H | Recombinant Human BST1 protein, His-tagged | +Inquiry |
BST1-1024R | Recombinant Rat BST1 Protein | +Inquiry |
BST1-3747HF | Recombinant Full Length Human BST1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *