Recombinant Human BTAF1 Protein, GST-tagged
Cat.No. : | BTAF1-365H |
Product Overview : | Human BTAF1 partial ORF ( NP_003963, 1750 a.a. - 1849 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Initiation of transcription by RNA polymerase II requires the assistance of TATA box-binding protein (TBP; MIM 600075) and TBP-associated factors, or TAFs (e.g., TAF2B; MIM 604912), in 2 distinct complexes, TFIID and B-TFIID. The TFIID complex is composed of TBP and more than 8 TAFs. However, the majority of TBP is present in the B-TFIID complex, which is composed of TBP and TAFII170, also called TAF172, and has DNA-dependent ATPase activity. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTAF1 BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1 homolog, S. cerevisiae) [ Homo sapiens ] |
Official Symbol | BTAF1 |
Synonyms | BTAF1; BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1 homolog, S. cerevisiae); BTAF1 RNA polymerase II, B TFIID transcription factor associated, 170 kD (Mot1 homolog, S. cerevisiae); TATA-binding protein-associated factor 172; MOT1; TAF(II)170; TAF 172; TAF172; TAFII170; TBP-associated factor 172; ATP-dependent helicase BTAF1; B-TFIID transcription factor-associated 170 kDa subunit; KIAA0940; MGC138406; |
Gene ID | 9044 |
mRNA Refseq | NM_003972 |
Protein Refseq | NP_003963 |
MIM | 605191 |
UniProt ID | O14981 |
◆ Recombinant Proteins | ||
BTAF1-365H | Recombinant Human BTAF1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTAF1 Products
Required fields are marked with *
My Review for All BTAF1 Products
Required fields are marked with *