Recombinant Human BTD Protein, GST-tagged
Cat.No. : | BTD-379H |
Product Overview : | Human BTD full-length ORF ( AAH12099, 1 a.a. - 543 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Biotinidase functions to recycle biotin in the body by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. Biotinidase has also been shown to have biotinyl-transferase activity. Defects in the biotinidase gene cause multiple carboxylase deficiency. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 85.47 kDa |
AA Sequence : | MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTD biotinidase [ Homo sapiens ] |
Official Symbol | BTD |
Synonyms | BTD; biotinidase; biotinase; |
Gene ID | 686 |
mRNA Refseq | NM_000060 |
Protein Refseq | NP_000051 |
MIM | 609019 |
UniProt ID | P43251 |
◆ Recombinant Proteins | ||
BTD-46H | Recombinant Human BTD, His-tagged | +Inquiry |
BTD-1666HF | Recombinant Full Length Human BTD Protein, GST-tagged | +Inquiry |
BTD-8838HFL | Recombinant Full Length Human BTD, Flag-tagged | +Inquiry |
BTD-379H | Recombinant Human BTD Protein, GST-tagged | +Inquiry |
Btd-1900M | Recombinant Mouse Btd Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTD-8395HCL | Recombinant Human BTD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTD Products
Required fields are marked with *
My Review for All BTD Products
Required fields are marked with *
0
Inquiry Basket