Recombinant Human BTF3L4 Protein, GST-tagged

Cat.No. : BTF3L4-381H
Product Overview : Human BTF3L4 full-length ORF ( NP_689478.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.7 kDa
AA Sequence : MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens ]
Official Symbol BTF3L4
Synonyms BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389;
Gene ID 91408
mRNA Refseq NM_001136497
Protein Refseq NP_001129969
UniProt ID Q96K17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTF3L4 Products

Required fields are marked with *

My Review for All BTF3L4 Products

Required fields are marked with *

0
cart-icon
0
compare icon