Recombinant Human BTF3L4 Protein, GST-tagged
Cat.No. : | BTF3L4-381H |
Product Overview : | Human BTF3L4 full-length ORF ( NP_689478.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens ] |
Official Symbol | BTF3L4 |
Synonyms | BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389; |
Gene ID | 91408 |
mRNA Refseq | NM_001136497 |
Protein Refseq | NP_001129969 |
UniProt ID | Q96K17 |
◆ Recombinant Proteins | ||
Btf3l4-1901M | Recombinant Mouse Btf3l4 Protein, Myc/DDK-tagged | +Inquiry |
BTF3L4-575R | Recombinant Rhesus monkey BTF3L4 Protein, His-tagged | +Inquiry |
BTF3L4-465H | Recombinant Human basic transcription factor 3-like 4, His-tagged | +Inquiry |
BTF3L4-1670H | Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BTF3L4-1668HF | Recombinant Full Length Human BTF3L4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTF3L4-8394HCL | Recombinant Human BTF3L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTF3L4 Products
Required fields are marked with *
My Review for All BTF3L4 Products
Required fields are marked with *