"BTF3L4" Related Products

Expand
Expand

Recombinant Human BTF3L4 Protein, GST-tagged

Cat.No. : BTF3L4-381H
Product Overview : Human BTF3L4 full-length ORF ( NP_689478.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.7 kDa
AA Sequence : MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

Gene Name : BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens ]
Official Symbol : BTF3L4
Synonyms : BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389;
Gene ID : 91408
mRNA Refseq : NM_001136497
Protein Refseq : NP_001129969
UniProt ID : Q96K17

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.