Recombinant Human BTG2 protein, GST-tagged

• Cat.No.: BTG2-30199H
• Product Overview: Recombinant Human BTG2 (1-50 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Tyr50
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: BTG2 BTG family, member 2 [ Homo sapiens ]
• Official Symbol: BTG2
• Synonyms: BTG2; BTG family, member 2; protein BTG2; B cell translocation gene 2; MGC126063; MGC126064; nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; PC3; pheochromacytoma cell 3; TIS21; pheochromacytoma cell-3; B-cell translocation gene 2; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative
• Gene ID: 7832
• mRNA Refseq: NM_006763
• Protein Refseq: NP_006754
• MIM: 601597
• UniProt ID: P78543