Recombinant Human BTG2 protein, GST-tagged
Cat.No. : | BTG2-30199H |
Product Overview : | Recombinant Human BTG2 (1-50 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Tyr50 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | BTG2 BTG family, member 2 [ Homo sapiens ] |
Official Symbol | BTG2 |
Synonyms | BTG2; BTG family, member 2; protein BTG2; B cell translocation gene 2; MGC126063; MGC126064; nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; PC3; pheochromacytoma cell 3; TIS21; pheochromacytoma cell-3; B-cell translocation gene 2; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative; |
Gene ID | 7832 |
mRNA Refseq | NM_006763 |
Protein Refseq | NP_006754 |
MIM | 601597 |
UniProt ID | P78543 |
◆ Recombinant Proteins | ||
BTG2-405R | Recombinant Rhesus Macaque BTG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTG2-8563Z | Recombinant Zebrafish BTG2 | +Inquiry |
BTG2-10320H | Recombinant Human BTG2 protein, GST-tagged | +Inquiry |
BTG2-30199H | Recombinant Human BTG2 protein, GST-tagged | +Inquiry |
BTG2-1030R | Recombinant Rat BTG2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTG2-8392HCL | Recombinant Human BTG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTG2 Products
Required fields are marked with *
My Review for All BTG2 Products
Required fields are marked with *