Recombinant Human BTG2 Protein, GST-tagged

Cat.No. : BTG2-383H
Product Overview : Human BTG2 full-length ORF ( NP_006754.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.8 kDa
AA Sequence : MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTG2 BTG family, member 2 [ Homo sapiens ]
Official Symbol BTG2
Synonyms BTG2; BTG family, member 2; protein BTG2; B cell translocation gene 2; MGC126063; MGC126064; nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; PC3; pheochromacytoma cell 3; TIS21; pheochromacytoma cell-3; B-cell translocation gene 2; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative;
Gene ID 7832
mRNA Refseq NM_006763
Protein Refseq NP_006754
MIM 601597
UniProt ID P78543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTG2 Products

Required fields are marked with *

My Review for All BTG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon