Recombinant Human BTG3 Protein, GST-tagged

Cat.No. : BTG3-385H
Product Overview : Human BTG3 full-length ORF ( AAH11957, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 58.08 kDa
AA Sequence : MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPTPVTWVPPPGMHCDRNHWINPHMLAPH
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTG3 BTG family, member 3 [ Homo sapiens ]
Official Symbol BTG3
Synonyms BTG3; BTG family, member 3; protein BTG3; ANA; tob55; protein Tob5; B-cell translocation gene 3; abundant in neuroepithelium area protein; TOB5; TOFA; TOB55; MGC8928;
Gene ID 10950
mRNA Refseq NM_001130914
Protein Refseq NP_001124386
MIM 605674
UniProt ID Q14201

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTG3 Products

Required fields are marked with *

My Review for All BTG3 Products

Required fields are marked with *

0
cart-icon