Recombinant Human BTG3 Protein, GST-tagged
| Cat.No. : | BTG3-385H |
| Product Overview : | Human BTG3 full-length ORF ( AAH11957, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 58.08 kDa |
| AA Sequence : | MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPTPVTWVPPPGMHCDRNHWINPHMLAPH |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BTG3 BTG family, member 3 [ Homo sapiens ] |
| Official Symbol | BTG3 |
| Synonyms | BTG3; BTG family, member 3; protein BTG3; ANA; tob55; protein Tob5; B-cell translocation gene 3; abundant in neuroepithelium area protein; TOB5; TOFA; TOB55; MGC8928; |
| Gene ID | 10950 |
| mRNA Refseq | NM_001130914 |
| Protein Refseq | NP_001124386 |
| MIM | 605674 |
| UniProt ID | Q14201 |
| ◆ Recombinant Proteins | ||
| BTG3-2533M | Recombinant Mouse BTG3 Protein | +Inquiry |
| BTG3-578R | Recombinant Rhesus monkey BTG3 Protein, His-tagged | +Inquiry |
| BTG3-385H | Recombinant Human BTG3 Protein, GST-tagged | +Inquiry |
| BTG3-1671HF | Recombinant Full Length Human BTG3 Protein, GST-tagged | +Inquiry |
| BTG3-406R | Recombinant Rhesus Macaque BTG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTG3-8391HCL | Recombinant Human BTG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTG3 Products
Required fields are marked with *
My Review for All BTG3 Products
Required fields are marked with *
