Recombinant Human BTG4 Protein, GST-tagged

Cat.No. : BTG4-386H
Product Overview : Human BTG4 full-length ORF ( AAH31045, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.4 kDa
AA Sequence : MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTG4 B-cell translocation gene 4 [ Homo sapiens ]
Official Symbol BTG4
Synonyms BTG4; B-cell translocation gene 4; protein BTG4; PC3B; protein PC3b; BTG family member 4; MGC33003;
Gene ID 54766
mRNA Refseq NM_017589
Protein Refseq NP_060059
MIM 605673
UniProt ID Q9NY30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTG4 Products

Required fields are marked with *

My Review for All BTG4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon