Recombinant Human BTG4 Protein, GST-tagged
Cat.No. : | BTG4-386H |
Product Overview : | Human BTG4 full-length ORF ( AAH31045, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTG4 B-cell translocation gene 4 [ Homo sapiens ] |
Official Symbol | BTG4 |
Synonyms | BTG4; B-cell translocation gene 4; protein BTG4; PC3B; protein PC3b; BTG family member 4; MGC33003; |
Gene ID | 54766 |
mRNA Refseq | NM_017589 |
Protein Refseq | NP_060059 |
MIM | 605673 |
UniProt ID | Q9NY30 |
◆ Recombinant Proteins | ||
BTG4-1672HF | Recombinant Full Length Human BTG4 Protein, GST-tagged | +Inquiry |
BTG4-10322H | Recombinant Human BTG4, GST-tagged | +Inquiry |
BTG4-386H | Recombinant Human BTG4 Protein, GST-tagged | +Inquiry |
BTG4-5378C | Recombinant Chicken BTG4 | +Inquiry |
BTG4-2830H | Recombinant Human BTG4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTG4-193HCL | Recombinant Human BTG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTG4 Products
Required fields are marked with *
My Review for All BTG4 Products
Required fields are marked with *
0
Inquiry Basket