Recombinant Human BTLA protein, mFc-Avi-tagged, Biotinylated
| Cat.No. : | BTLA-7453H |
| Product Overview : | Recombinant Human BTLA protein(Q7Z6A9)(31-150aa), fused with C-terminal mFc and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Avi&mFc |
| Protein Length : | 31-150aa |
| Tag : | C-mFc-Avi |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.7 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
| Conjugation : | Biotin |
| Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
| Official Symbol | BTLA |
| Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
| Gene ID | 151888 |
| mRNA Refseq | NM_001085357 |
| Protein Refseq | NP_001078826 |
| MIM | 607925 |
| UniProt ID | Q7Z6A9 |
| ◆ Recombinant Proteins | ||
| BTLA-7453H | Recombinant Human BTLA protein, mFc-Avi-tagged, Biotinylated | +Inquiry |
| Btla-1844R | Recombinant Rat Btla protein, His & T7-tagged | +Inquiry |
| BTLA-1373C | Recombinant Cynomolgus BTLA protein, His-tagged | +Inquiry |
| BTLA-566H | Active Recombinant Human BTLA Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
| BTLA-018H | Recombinant Human BTLA protein, DDK/HIS-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
| BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
