Recombinant Human BTLA protein, mFc-Avi-tagged, Biotinylated

Cat.No. : BTLA-7453H
Product Overview : Recombinant Human BTLA protein(Q7Z6A9)(31-150aa), fused with C-terminal mFc and Avi tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&mFc
Protein Length : 31-150aa
Tag : C-mFc-Avi
Conjugation/Label : Biotin
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.7 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Conjugation : Biotin
Gene Name BTLA B and T lymphocyte associated [ Homo sapiens ]
Official Symbol BTLA
Synonyms BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743;
Gene ID 151888
mRNA Refseq NM_001085357
Protein Refseq NP_001078826
MIM 607925
UniProt ID Q7Z6A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTLA Products

Required fields are marked with *

My Review for All BTLA Products

Required fields are marked with *

0
cart-icon