Recombinant Human BTLA protein, mFc-Avi-tagged, Biotinylated
Cat.No. : | BTLA-7453H |
Product Overview : | Recombinant Human BTLA protein(Q7Z6A9)(31-150aa), fused with C-terminal mFc and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&mFc |
Protein Length : | 31-150aa |
Tag : | C-mFc-Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
Official Symbol | BTLA |
Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
Gene ID | 151888 |
mRNA Refseq | NM_001085357 |
Protein Refseq | NP_001078826 |
MIM | 607925 |
UniProt ID | Q7Z6A9 |
◆ Recombinant Proteins | ||
BTLA-017H | Recombinant Human BTLA protein, DDK/HIS-tagged | +Inquiry |
BTLA-1386H | Recombinant Human BTLA protein(Met1-Thr134), mFc-tagged | +Inquiry |
BTLA-1373C | Recombinant Cynomolgus BTLA protein, His-tagged | +Inquiry |
BTLA-372H | Recombinant Human BTLA Protein, DYKDDDDK-tagged | +Inquiry |
BTLA-8698M | Recombinant Mouse BTLA protein(Met1-Gly176), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *