Recombinant Human BTN2A1 Protein, GST-tagged
| Cat.No. : | BTN2A1-393H |
| Product Overview : | Human BTN2A1 full-length ORF ( AAH16661, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 62.48 kDa |
| AA Sequence : | MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BTN2A1 butyrophilin, subfamily 2, member A1 [ Homo sapiens ] |
| Official Symbol | BTN2A1 |
| Synonyms | BTN2A1; butyrophilin, subfamily 2, member A1; butyrophilin subfamily 2 member A1; BT2.1; BTF1; butyrophilin BTF1; DJ3E1.1; BK14H9.1; FLJ36567; |
| Gene ID | 11120 |
| mRNA Refseq | NM_001197233 |
| Protein Refseq | NP_001184162 |
| MIM | 613590 |
| UniProt ID | Q7KYR7 |
| ◆ Recombinant Proteins | ||
| BTN2A1-6218H | Recombinant Human BTN2A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BTN2A1-2899H | Recombinant Human BTN2A1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| BTN2A1-3689H | Recombinant Human BTN2A1 protein, rFc-tagged | +Inquiry |
| BTN2A1-1675HF | Recombinant Full Length Human BTN2A1 Protein, GST-tagged | +Inquiry |
| BTN2A1-1679H | Recombinant Human BTN2A1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTN2A1-8389HCL | Recombinant Human BTN2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN2A1 Products
Required fields are marked with *
My Review for All BTN2A1 Products
Required fields are marked with *



