Recombinant Human BTN2A1 Protein, GST-tagged
Cat.No. : | BTN2A1-393H |
Product Overview : | Human BTN2A1 full-length ORF ( AAH16661, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62.48 kDa |
AA Sequence : | MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTN2A1 butyrophilin, subfamily 2, member A1 [ Homo sapiens ] |
Official Symbol | BTN2A1 |
Synonyms | BTN2A1; butyrophilin, subfamily 2, member A1; butyrophilin subfamily 2 member A1; BT2.1; BTF1; butyrophilin BTF1; DJ3E1.1; BK14H9.1; FLJ36567; |
Gene ID | 11120 |
mRNA Refseq | NM_001197233 |
Protein Refseq | NP_001184162 |
MIM | 613590 |
UniProt ID | Q7KYR7 |
◆ Recombinant Proteins | ||
BTN2A1-2217H | Recombinant Human BTN2A1 protein, His-tagged | +Inquiry |
BTN2A1-2899H | Recombinant Human BTN2A1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
BTN2A1-1679H | Recombinant Human BTN2A1 protein, His-tagged | +Inquiry |
BTN2A1-3248H | Recombinant Human BTN2A1 protein, His-tagged | +Inquiry |
BTN2A1-393H | Recombinant Human BTN2A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN2A1-8389HCL | Recombinant Human BTN2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN2A1 Products
Required fields are marked with *
My Review for All BTN2A1 Products
Required fields are marked with *
0
Inquiry Basket