Recombinant Human BTN2A1 Protein, GST-tagged

• Cat.No.: BTN2A1-393H
• Product Overview: Human BTN2A1 full-length ORF ( AAH16661, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 62.48 kDa
• AA Sequence: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTN2A1 butyrophilin, subfamily 2, member A1 [ Homo sapiens ]
• Official Symbol: BTN2A1
• Synonyms: BTN2A1; butyrophilin, subfamily 2, member A1; butyrophilin subfamily 2 member A1; BT2.1; BTF1; butyrophilin BTF1; DJ3E1.1; BK14H9.1; FLJ36567
• Gene ID: 11120
• mRNA Refseq: NM_001197233
• Protein Refseq: NP_001184162
• MIM: 613590
• UniProt ID: Q7KYR7