Recombinant Human BTN3A1 Protein (30-254 aa), His-tagged
Cat.No. : | BTN3A1-2331H |
Product Overview : | Recombinant Human BTN3A1 Protein (30-254 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 30-254 aa |
Description : | Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.2 kDa |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | BTN3A1 butyrophilin, subfamily 3, member A1 [ Homo sapiens ] |
Official Symbol | BTN3A1 |
Synonyms | BTN3A1; butyrophilin subfamily 3 member A1; BT3.1; BTF5; CD277; MGC141880; |
Gene ID | 11119 |
mRNA Refseq | NM_001145008 |
Protein Refseq | NP_001138480 |
MIM | 613593 |
UniProt ID | O00481 |
◆ Recombinant Proteins | ||
BTN3A1-1530HFL | Recombinant Full Length Human BTN3A1 Protein, C-Flag-tagged | +Inquiry |
BTN3A1-736H | Recombinant Human BTN3A1 protein, Fc-tagged | +Inquiry |
BTN3A1-3960H | Recombinant Human BTN3A1 Protein (Met1-Gly254), C-His tagged | +Inquiry |
BTN3A1-47HB | Recombinant Human BTN3A1 protein, His-tagged, Biotinylated | +Inquiry |
BTN3A1-363H | Recombinant Human BTN3A1 Protein (30-254 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A1-8386HCL | Recombinant Human BTN3A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A1 Products
Required fields are marked with *
My Review for All BTN3A1 Products
Required fields are marked with *
0
Inquiry Basket