Recombinant Human BTN3A1 Protein (30-254 aa), His-tagged

Cat.No. : BTN3A1-2331H
Product Overview : Recombinant Human BTN3A1 Protein (30-254 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 30-254 aa
Description : Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.2 kDa
AA Sequence : QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name BTN3A1 butyrophilin, subfamily 3, member A1 [ Homo sapiens ]
Official Symbol BTN3A1
Synonyms BTN3A1; butyrophilin subfamily 3 member A1; BT3.1; BTF5; CD277; MGC141880;
Gene ID 11119
mRNA Refseq NM_001145008
Protein Refseq NP_001138480
MIM 613593
UniProt ID O00481

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTN3A1 Products

Required fields are marked with *

My Review for All BTN3A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon