Recombinant Human BTNL2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | BTNL2-103H |
| Product Overview : | Recombinant Human BTNL2(Lys24-Trp455) fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-455aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.3 kDa |
| AA Sequence : | MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BTNL2 butyrophilin-like 2 (MHC class II associated) [ Homo sapiens ] |
| Official Symbol | BTNL2 |
| Synonyms | SS2; BTL-II; HSBLMHC1 |
| Gene ID | 56244 |
| mRNA Refseq | NM_019602.1 |
| Protein Refseq | NP_062548.1 |
| MIM | 606000 |
| UniProt ID | Q9UIR0 |
| ◆ Recombinant Proteins | ||
| BTNL2-2033H | Active Recombinant Human BTNL2, MIgG2a Fc-tagged | +Inquiry |
| BTNL2-103H | Recombinant Human BTNL2 Full Length Transmembrane protein, His-tagged | +Inquiry |
| BTNL2-4353H | Recombinant Human BTNL2 protein, GST-tagged | +Inquiry |
| BTNL2-0799H | Recombinant Human BTNL2 Protein (Ser26-Gly454), C-His tagged | +Inquiry |
| BTNL2-4538H | Recombinant Human BTNL2 protein, hFc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTNL2 Products
Required fields are marked with *
My Review for All BTNL2 Products
Required fields are marked with *




