Recombinant Human BTNL3 protein, MBP&His-Avi-tagged, Biotinylated

• Cat.No.: BTNL3-6463H
• Product Overview: Biotinylated Recombinant Human BTNL3 protein(Q6UXE8)(18-237aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 18-237a.a.
• Tag: MBP&His&Avi
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 72.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGETFFQPSPWRLAS
• Conjugation: Biotin

Gene Information

• Gene Name: BTNL3 butyrophilin-like 3 [ Homo sapiens ]
• Official Symbol: BTNL3
• Synonyms: BTNL3; butyrophilin-like 3; butyrophilin-like protein 3; BTNLR; butyrophilin like receptor; butyrophilin-like receptor
• Gene ID: 10917
• mRNA Refseq: NM_197975
• Protein Refseq: NP_932079
• MIM: 606192
• UniProt ID: Q6UXE8