Recombinant Human BTNL3 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | BTNL3-6463H |
Product Overview : | Biotinylated Recombinant Human BTNL3 protein(Q6UXE8)(18-237aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 18-237a.a. |
Tag : | MBP&His&Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 72.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGETFFQPSPWRLAS |
Gene Name | BTNL3 butyrophilin-like 3 [ Homo sapiens ] |
Official Symbol | BTNL3 |
Synonyms | BTNL3; butyrophilin-like 3; butyrophilin-like protein 3; BTNLR; butyrophilin like receptor; butyrophilin-like receptor; |
Gene ID | 10917 |
mRNA Refseq | NM_197975 |
Protein Refseq | NP_932079 |
MIM | 606192 |
UniProt ID | Q6UXE8 |
◆ Recombinant Proteins | ||
BTNL3-397H | Recombinant Human BTNL3 Protein, GST-tagged | +Inquiry |
BTNL3-6463H | Recombinant Human BTNL3 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
BTNL3-1679HF | Recombinant Full Length Human BTNL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTNL3-194HCL | Recombinant Human BTNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTNL3 Products
Required fields are marked with *
My Review for All BTNL3 Products
Required fields are marked with *
0
Inquiry Basket