Recombinant Human BTNL9 protein, His-tagged

Cat.No. : BTNL9-49H
Product Overview : Recombinant Human Butyrophilin-like Protein 9 is produced by our Mammalian expression system and the target gene encoding Glu48-Ser160 is expressed with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Glu48-Ser160
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
AA Sequence : EVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFR NRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 90% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name BTNL9 butyrophilin-like 9 [ Homo sapiens ]
Official Symbol BTNL9
Synonyms BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900;
Gene ID 153579
mRNA Refseq NM_152547
Protein Refseq NP_689760
UniProt ID Q6UXG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTNL9 Products

Required fields are marked with *

My Review for All BTNL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon