Recombinant Human BTNL9 protein, His-tagged
| Cat.No. : | BTNL9-49H |
| Product Overview : | Recombinant Human Butyrophilin-like Protein 9 is produced by our Mammalian expression system and the target gene encoding Glu48-Ser160 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Glu48-Ser160 |
| Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| AA Sequence : | EVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFR NRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 90% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | BTNL9 butyrophilin-like 9 [ Homo sapiens ] |
| Official Symbol | BTNL9 |
| Synonyms | BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900; |
| Gene ID | 153579 |
| mRNA Refseq | NM_152547 |
| Protein Refseq | NP_689760 |
| UniProt ID | Q6UXG8 |
| ◆ Recombinant Proteins | ||
| BTNL9-001M | Active Recombinant Mouse Btnl9 Protein, Fc-tagged | +Inquiry |
| Btnl9-6M | Recombinant Mouse Btnl9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BTNL9-49H | Recombinant Human BTNL9 protein, His-tagged | +Inquiry |
| BTNL9-002M | Recombinant Human BTNL9(Asp36-Lys257) Protein, C-Fc-tagged | +Inquiry |
| BTNL9-2813H | Recombinant Human BTNL9 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTNL9 Products
Required fields are marked with *
My Review for All BTNL9 Products
Required fields are marked with *



