Recombinant Human BUB1 protein, His-tagged
Cat.No. : | BUB1-2948H |
Product Overview : | Recombinant Human BUB1 protein(785-1083 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 785-1083 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) [ Homo sapiens ] |
Official Symbol | BUB1 |
Synonyms | BUB1; budding uninhibited; BUB1L, budding uninhibited by benzimidazoles 1 (yeast homolog); mitotic checkpoint serine/threonine-protein kinase BUB1; BUB1A; hBUB1; mitotic spindle checkpoint kinase; putative serine/threonine-protein kinase; BUB1 budding uninhibited by benzimidazoles 1 homolog; BUB1L; |
Gene ID | 699 |
mRNA Refseq | NM_004336 |
Protein Refseq | NP_004327 |
MIM | 602452 |
UniProt ID | O43683 |
◆ Recombinant Proteins | ||
BUB1-2088C | Recombinant Chicken BUB1 | +Inquiry |
BUB1-462H | Recombinant Human BUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BUB1-2948H | Recombinant Human BUB1 protein, His-tagged | +Inquiry |
Bub1-725M | Recombinant Mouse Bub1 Protein, MYC/DDK-tagged | +Inquiry |
BUB1-2408H | Recombinant Human BUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BUB1-8383HCL | Recombinant Human BUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BUB1 Products
Required fields are marked with *
My Review for All BUB1 Products
Required fields are marked with *