Recombinant Human BUB1 protein, His-tagged
| Cat.No. : | BUB1-2948H |
| Product Overview : | Recombinant Human BUB1 protein(785-1083 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 785-1083 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) [ Homo sapiens ] |
| Official Symbol | BUB1 |
| Synonyms | BUB1; budding uninhibited; BUB1L, budding uninhibited by benzimidazoles 1 (yeast homolog); mitotic checkpoint serine/threonine-protein kinase BUB1; BUB1A; hBUB1; mitotic spindle checkpoint kinase; putative serine/threonine-protein kinase; BUB1 budding uninhibited by benzimidazoles 1 homolog; BUB1L; |
| Gene ID | 699 |
| mRNA Refseq | NM_004336 |
| Protein Refseq | NP_004327 |
| MIM | 602452 |
| UniProt ID | O43683 |
| ◆ Recombinant Proteins | ||
| BUB1-2948H | Recombinant Human BUB1 protein, His-tagged | +Inquiry |
| BUB1-595H | Recombinant Human BUB1 | +Inquiry |
| BUB1-5059HF | Active Recombinant Full Length Human BUB1 Protein, GST-tagged | +Inquiry |
| BUB1-2564H | Recombinant Human BUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BUB1-7843H | Recombinant Human BUB1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BUB1-8383HCL | Recombinant Human BUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BUB1 Products
Required fields are marked with *
My Review for All BUB1 Products
Required fields are marked with *
