Recombinant Human BUD31 Protein, GST-tagged
| Cat.No. : | BUD31-4604H |
| Product Overview : | Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | BUD31 (BUD31 Homolog) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. |
| Molecular Mass : | 41.47 kDa |
| AA Sequence : | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BUD31 BUD31 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | BUD31 |
| Synonyms | BUD31; BUD31 homolog (S. cerevisiae); BUD31 homolog (yeast); protein BUD31 homolog; EDG 2; EDG2; fSAP17; functional spliceosome associated protein 17; G10; G10 maternal transcript homolog (Xenopus laevis); YCR063W; protein EDG-2; protein G10 homolog; maternal G10 transcript; G10 maternal transcript homolog; functional spliceosome-associated protein 17; EDG-2; MGC111202; |
| Gene ID | 8896 |
| mRNA Refseq | NM_003910 |
| Protein Refseq | NP_003901 |
| MIM | 603477 |
| UniProt ID | P41223 |
| ◆ Recombinant Proteins | ||
| BUD31-4604H | Recombinant Human BUD31 Protein, GST-tagged | +Inquiry |
| BUD31-7624H | Recombinant Human BUD31, His-tagged | +Inquiry |
| BUD31-2550M | Recombinant Mouse BUD31 Protein | +Inquiry |
| BUD31-1121M | Recombinant Mouse BUD31 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BUD31-581R | Recombinant Rhesus monkey BUD31 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BUD31-8380HCL | Recombinant Human BUD31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BUD31 Products
Required fields are marked with *
My Review for All BUD31 Products
Required fields are marked with *



